Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 4 (Tas2r4)

This Recombinant Rat Taste receptor type 2 member 4 (Tas2r4) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 4, T2R4, T2R16, Taste receptor type 2 member 20, T2R20

UniProt

Q67ET0

Expression Region

1-304

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWELYAFVFAASVVFNFVGIVANLFIIVIISKTWVKSHKISSSDKILFSLAITRFLTLG LFLLNTVYIATNTGRSVYFSTFFLLCWKFLDSNSLWLVTFLNCLYCVKITHFQHPVFLLL KRTVSMKTTSLLLACLLISAFTTLLYFVLTQISRFPEHIIGRNDTLFDVSDGILTLAASL ILSSLLQFLLNVTFASLLIHSLRRHVQKMQRNRSSFWNPQTEAHVGAMRLMICFLVLYIP YSIAALLYFPSYMRKNLRAQAACMIITAAYPPGHSILLIITHHKLKAKAKKICCFYKLRD FVSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysyl Oxidase Like 1 (LOXL1) Antibody
abx103040-01 100 µL

Lysyl Oxidase Like 1 (LOXL1) Antibody

Sign In for Pricing
View Details
Lysyl Oxidase Like 1 (LOXL1) Antibody
abx103040-02 200 µL

Lysyl Oxidase Like 1 (LOXL1) Antibody

Sign In for Pricing
View Details
Lysyl Oxidase Like 1 (LOXL1) Antibody
abx103040-03 1 mL

Lysyl Oxidase Like 1 (LOXL1) Antibody

Sign In for Pricing
View Details
TRB1 Antibody
PHY7863S 150 μg

TRB1 Antibody

Sign In for Pricing
View Details
Claudin 2 (CLDN2) (FITC)
MBS6469255-01 0.1 mL

Claudin 2 (CLDN2) (FITC)

Sign In for Pricing
View Details
Claudin 2 (CLDN2) (FITC)
MBS6469255-02 5x 0.1 mL

Claudin 2 (CLDN2) (FITC)

Sign In for Pricing
View Details