Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 4 (Tas2r4)

This Recombinant Rat Taste receptor type 2 member 4 (Tas2r4) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 4, T2R4, T2R16, Taste receptor type 2 member 20, T2R20

UniProt

Q67ET0

Expression Region

1-304

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWELYAFVFAASVVFNFVGIVANLFIIVIISKTWVKSHKISSSDKILFSLAITRFLTLG LFLLNTVYIATNTGRSVYFSTFFLLCWKFLDSNSLWLVTFLNCLYCVKITHFQHPVFLLL KRTVSMKTTSLLLACLLISAFTTLLYFVLTQISRFPEHIIGRNDTLFDVSDGILTLAASL ILSSLLQFLLNVTFASLLIHSLRRHVQKMQRNRSSFWNPQTEAHVGAMRLMICFLVLYIP YSIAALLYFPSYMRKNLRAQAACMIITAAYPPGHSILLIITHHKLKAKAKKICCFYKLRD FVSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ACVAB (Activin AB) ELISA Kit
EH25686 96 Tests

Human ACVAB (Activin AB) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal GRAP2 Antibody (OTI1G2) [DyLight 350]
NBP2-71457UV 0.1 mL

Mouse Monoclonal GRAP2 Antibody (OTI1G2) [DyLight 350]

Sign In for Pricing
View Details
4-Nitrophenyl b-D-xylotrioside
EN44935-01 1 mg

4-Nitrophenyl b-D-xylotrioside

Sign In for Pricing
View Details
4-Nitrophenyl b-D-xylotrioside
EN44935-02 2 mg

4-Nitrophenyl b-D-xylotrioside

Sign In for Pricing
View Details
4-Nitrophenyl b-D-xylotrioside
EN44935-03 5 mg

4-Nitrophenyl b-D-xylotrioside

Sign In for Pricing
View Details
4-Nitrophenyl b-D-xylotrioside
EN44935-04 10 mg

4-Nitrophenyl b-D-xylotrioside

Sign In for Pricing
View Details