Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5M11 (OR5M11)

This Recombinant Human Olfactory receptor 5M11 (OR5M11) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Olfactory receptor 5M11

UniProt

Q96RB7

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNTNGSAITEFILLGLTDCPELQSLLFVLFLVVYLVTLLGNLGMIMLMRLDSRLHTPMY FFLTNLAFVDLCYTSNATPQMSTNIVSEKTISFAGCFTQCYIFIALLLTEFYMLAAMAYD RYVAIYDPLRYSVKTSRRVCICLATFPYVYGFSDGLFQAILTFRLTFCRSSVINHFYCAD PPLIKLSCSDTYVKEHAMFISAGFNLSSSLTIVLVSYAFILAAILRIKSAEGRHKAFSTC GSHMMAVTLFYGTLFCMYIRPPTDKTVEESKIIAVFYTFVSPVLNPLIYSLRNKDVKQAL KNVLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842L-01 20 Tests

Elab Fluor® 488 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® 488 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842L-02 100 Tests

Elab Fluor® 488 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® 488 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842L-03 2x 100 Tests

Elab Fluor® 488 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Human RMND5A activation kit by CRISPRa
GA112154 1 Kit

Human RMND5A activation kit by CRISPRa

Sign In for Pricing
View Details
Langerin (CD207) (NM_015717) Human Recombinant Protein
TP304669M 100 µg

Langerin (CD207) (NM_015717) Human Recombinant Protein

Sign In for Pricing
View Details
A930018P22Rik (NM_026634) Mouse Tagged ORF Clone
MG201883 10 µg

A930018P22Rik (NM_026634) Mouse Tagged ORF Clone

Sign In for Pricing
View Details