Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 73 protein (mug73)

This Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 73 protein (mug73) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Meiotically up-regulated gene 73 protein

UniProt

O74870

Expression Region

1-306

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAKLSSSGMVLKELPEVALQKISSNYYWAVFAVFLLCAIVFPLVSIFSLPQKQTYHRFF SILSLVSCLAYFTMACNYGLKNVFSSASFFREVSVRMVYYVRYIQWLINFPLIIVMLHWT VGVSILEIAYVVCYVLFAIVCLLAAALTSSPYKWAYYGFSFVGYFIALAHSVVLHKKYAS RLETSARLGFLWSIVYLHVIWFLYYACWILSEGLNVISPIGEAIFYSILDLFEFGFFGAA FSWMLDLVGIENFKSPQSIPLGACSPADDKFSMCPDMEAQNQADDLAVETRIQISNLPSS PTKNNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-500 1x 500 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF405S conjugate, 0.1mg/mL
BNC042078-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details