Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 106 (Tas2r106)

This Recombinant Rat Taste receptor type 2 member 106 (Tas2r106) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 106, T2R106, Taste receptor type 2 member 19, T2R19

UniProt

Q67ET1

Expression Region

1-307

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTIPEGILLCFITSGSVLGVLGNGFILHVNCTDCVRQKFSTTGFIFTGLAISRICVICI IISDGYLKLFSPHMVASDAHIIGISYLWIITNHTSTCFATILNLFYFLKIANFSHYIFFC LKRKLNTIFIFLLGCLFISWSVAFPQTVKIFNDKMKHRNTSWKFHLHKSKFIINHILLNL GVIFFCMVAIITSFLLIISLWKHNRKMQLYVSRFKSLNTEVHLKVMKVLISFIILLILHV IGILIETLSFLRYENKLLLILGLNFSSMYPCCHSFILILANNQLKQASLKALKQFKCHKK DKDVRET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Viloxazine-d5 Hydrochloride
TRC-V312442-1MG 1 mg

rac Viloxazine-d5 Hydrochloride

Sign In for Pricing
View Details
(S)-(+)-Mandelic Acid
TRC-M162535-25G 25 g

(S)-(+)-Mandelic Acid

Sign In for Pricing
View Details
Human TTDN1 (MPLKIP) activation kit by CRISPRa
GA115274 1 Kit

Human TTDN1 (MPLKIP) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin L/CTSL Protein (aa 1-334, His Tag)
PKSM040915 50 µg

Recombinant Mouse Cathepsin L/CTSL Protein (aa 1-334, His Tag)

Sign In for Pricing
View Details
Tmem81 Mouse Gene Knockout Kit (CRISPR)
KN517903 1 Kit

Tmem81 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700363 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details