Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 106 (Tas2r106)

This Recombinant Rat Taste receptor type 2 member 106 (Tas2r106) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 106, T2R106, Taste receptor type 2 member 19, T2R19

UniProt

Q67ET1

Expression Region

1-307

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTIPEGILLCFITSGSVLGVLGNGFILHVNCTDCVRQKFSTTGFIFTGLAISRICVICI IISDGYLKLFSPHMVASDAHIIGISYLWIITNHTSTCFATILNLFYFLKIANFSHYIFFC LKRKLNTIFIFLLGCLFISWSVAFPQTVKIFNDKMKHRNTSWKFHLHKSKFIINHILLNL GVIFFCMVAIITSFLLIISLWKHNRKMQLYVSRFKSLNTEVHLKVMKVLISFIILLILHV IGILIETLSFLRYENKLLLILGLNFSSMYPCCHSFILILANNQLKQASLKALKQFKCHKK DKDVRET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl Iminodiacetate
TRC-D442270-2.5G 2.5 g

Diethyl Iminodiacetate

Sign In for Pricing
View Details
Nivolumab Biosimilar - Research Grade
ICH4009-10mg 10 mg (2x 5 mg)

Nivolumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Vandetanib-d5 (Major)
TRC-V974655-100MG 100 mg

Vandetanib-d5 (Major)

Sign In for Pricing
View Details
Floor Type High Speed Refrigerated Centrifuge BCFHR-305
BCFHR-305 1 Unit

Floor Type High Speed Refrigerated Centrifuge BCFHR-305

Sign In for Pricing
View Details
CNPY3 Polyclonal Antibody
E-AB-52728-01 20 µL

CNPY3 Polyclonal Antibody

Sign In for Pricing
View Details
CNPY3 Polyclonal Antibody
E-AB-52728-02 60 µL

CNPY3 Polyclonal Antibody

Sign In for Pricing
View Details