Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 106 (Tas2r106)

This Recombinant Rat Taste receptor type 2 member 106 (Tas2r106) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 106, T2R106, Taste receptor type 2 member 19, T2R19

UniProt

Q67ET1

Expression Region

1-307

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTIPEGILLCFITSGSVLGVLGNGFILHVNCTDCVRQKFSTTGFIFTGLAISRICVICI IISDGYLKLFSPHMVASDAHIIGISYLWIITNHTSTCFATILNLFYFLKIANFSHYIFFC LKRKLNTIFIFLLGCLFISWSVAFPQTVKIFNDKMKHRNTSWKFHLHKSKFIINHILLNL GVIFFCMVAIITSFLLIISLWKHNRKMQLYVSRFKSLNTEVHLKVMKVLISFIILLILHV IGILIETLSFLRYENKLLLILGLNFSSMYPCCHSFILILANNQLKQASLKALKQFKCHKK DKDVRET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (C66/1009), 0.2mg/mL
BNUB1009-100 1x 100 µL

CD66 (CEA) (C66/1009), 0.2mg/mL

Sign In for Pricing
View Details
IFluor® 555 PSA™ Imaging Kit with Goat Anti-Rabbit IgG
45220-AAT 100 Tests

IFluor® 555 PSA™ Imaging Kit with Goat Anti-Rabbit IgG

Sign In for Pricing
View Details
Mouse CTSL Antibody Pair Set
E-KAB-0584 50 µL & 100 µg

Mouse CTSL Antibody Pair Set

Sign In for Pricing
View Details
GNGT1 Rabbit Polyclonal Antibody
TA376658 100 µL

GNGT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SKI activation kit by CRISPRa
GA104423 1 Kit

Human SKI activation kit by CRISPRa

Sign In for Pricing
View Details
(S)-3-Benzyloxycarbonyl-4-(3-oxobutyl)-5-oxazilidinone
TRC-B285920-50MG 50 mg

(S)-3-Benzyloxycarbonyl-4-(3-oxobutyl)-5-oxazilidinone

Sign In for Pricing
View Details