Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable polyprenol reductase (B0024.13)

This Recombinant Probable polyprenol reductase (B0024.13) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Probable polyprenol reductase, EC= 1.3.1.-

UniProt

Q17428

Expression Region

1-309

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDRLWEVRQALPLYLLVSTLGLAISCCFTLICPHVCRLIPALTTYGKAADQQEDNSLVE KISVPKKWFKHFYAIGLLTLFICLHTVHSLIYNPNYLHPVVLKILATLTRSYSIPPITPS TSILALLLISLHVARRLYETIFVSVYSDSRMNLFHYAVGIVHYIILPISIMCETQGVASK LPQLHVSIDDISLTQWAGAVLFWICNWKQHQLAEQIANTRKGPRGLIRNYAYGICFGGWF NLVSCPHFLFEICIYLSLFLVIPDAYVYRFIIMFVCINQTFAALITHSWYHKTFPKYPKS RKALIPYVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4 Transcription Factor (HINFP) Antibody (FITC)
abx335977-01 20 µg

Histone H4 Transcription Factor (HINFP) Antibody (FITC)

Sign In for Pricing
View Details
Histone H4 Transcription Factor (HINFP) Antibody (FITC)
abx335977-02 50 µg

Histone H4 Transcription Factor (HINFP) Antibody (FITC)

Sign In for Pricing
View Details
Histone H4 Transcription Factor (HINFP) Antibody (FITC)
abx335977-03 100 µg

Histone H4 Transcription Factor (HINFP) Antibody (FITC)

Sign In for Pricing
View Details
Histone H4 Transcription Factor (HINFP) Antibody (FITC)
abx335977-04 200 µg

Histone H4 Transcription Factor (HINFP) Antibody (FITC)

Sign In for Pricing
View Details
Histone H4 Transcription Factor (HINFP) Antibody (FITC)
abx335977-05 1 mg

Histone H4 Transcription Factor (HINFP) Antibody (FITC)

Sign In for Pricing
View Details
Tert-Butyl 4- (5-fluoro-1H-indazol-3-yl) piperidine-1-carboxylate
PC430281-01 100 mg

Tert-Butyl 4- (5-fluoro-1H-indazol-3-yl) piperidine-1-carboxylate

Sign In for Pricing
View Details