Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Olfactory receptor 1D2 (OR1D2)

This Recombinant Gorilla gorilla gorilla Olfactory receptor 1D2 (OR1D2) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D2

UniProt

Q9TU93

Expression Region

1-312

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGGNQSEGSEFLLLGMSESPEQQQILFWMFLSMYLVTVVGNVLIILAINSDSHLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVALDNLILAVMAY DRYVAICCPLHYTTAMSPKLCILLLSLCWVLSVLYGLIHTILMTRVTFCGSRKIHYIFCE MYVLLRMACSNIQINHTVLIATGCFIFLIPFGFVIISYVLIIRAILRIPSVSKKYKAFST CASHLGAVSLFYGTLCMVYLKPLHTFSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL GRLLDTHFKRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Se
MBS6483737-01 0.2 mL

JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Se

Sign In for Pricing
View Details
JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Se
MBS6483737-02 5x 0.2 mL

JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Se

Sign In for Pricing
View Details
PPQ-581
T28443 25 mg

PPQ-581

Sign In for Pricing
View Details
Imeglimin
B1212-100 100 mg

Imeglimin

Sign In for Pricing
View Details
Dmgdh (NM_028772) Mouse Tagged ORF Clone
MG224057 10 µg

Dmgdh (NM_028772) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Gas8 sgRNA CRISPR Lentivector set (Mouse)
K3510601 3x 1.0 µg

Gas8 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details