Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1D5 (OR1D5)

This Recombinant Human Olfactory receptor 1D5 (OR1D5) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 1D5, Olfactory receptor 17-31, OR17-31

UniProt

P58170

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGDNQSENSQFLLLGISESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMY FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY DRYVATCCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCD MYILLWLACSNTHIIHTALIATGCFIFLTPLGFMTTSYVRIVRTILQMPSASKKYKTFST CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYRLRNKDMHGAP GRVLWRPFQRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD54B Antibody
DF9055-01 100 µL

RAD54B Antibody

Sign In for Pricing
View Details
RAD54B Antibody
DF9055-02 200 µL

RAD54B Antibody

Sign In for Pricing
View Details
Rat Leukemia Inhibitory Factor ELISA kit
GTR10421110 96 Well

Rat Leukemia Inhibitory Factor ELISA kit

Sign In for Pricing
View Details
B230118H07Rik (NM_026592) Mouse Recombinant Protein
TP503048 20 µg

B230118H07Rik (NM_026592) Mouse Recombinant Protein

Sign In for Pricing
View Details
Compound FL0144
orb3169892-01 5 mg

Compound FL0144

Sign In for Pricing
View Details
Compound FL0144
orb3169892-02 10 mg

Compound FL0144

Sign In for Pricing
View Details