Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51A4 (OR51A4)

This Recombinant Human Olfactory receptor 51A4 (OR51A4) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 51A4

UniProt

Q8NGJ6

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHEP MYYFLSMLAMSDLGLSLSSLPTVLSIFLFNAPEISSNACFAQEFFIHGFSVLESSVLLIM SFDRFLAIHNPLRYTSILTTVRVAQIGIVFSFKSMLLVLPFPFTLRNLRYCKKNQLSHSY CLHQDVMKLACSDNRIDVIYGFFGALCLMVDFILIAVSYTLILKTVLGIASKKEQLKALN TCVSHICAVIIFYLPIINLAVVHRFARHVSPLINVLMANVLLLVPPLTNPIVYCVKTKQI RVRVVAKLCQRKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTRA1 Polyclonal Antibody
D-AB-10103L-01 25 µL

HTRA1 Polyclonal Antibody

Sign In for Pricing
View Details
HTRA1 Polyclonal Antibody
D-AB-10103L-02 100 µL

HTRA1 Polyclonal Antibody

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]
TA806586BM 100 µL

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9F11]
CF805577 100 µg

hnRNP L (HNRNPL) Mouse Monoclonal Antibody [Clone ID: OTI9F11]

Sign In for Pricing
View Details
Human MIA3 activation kit by CRISPRa
GA117803 1 Kit

Human MIA3 activation kit by CRISPRa

Sign In for Pricing
View Details
AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]
E-AB-F098530-01 100 µg

AF/LE Purified Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details