Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5H15 (OR5H15)

This Recombinant Human Olfactory receptor 5H15 (OR5H15) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Olfactory receptor 5H15

UniProt

A6NDH6

Expression Region

1-313

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEENATLLTEFVLTGFLYQPQWKIPLFLAFLVIYLITIMGNLGLIAVIWKDPHLHIPMY LLLGNLAFVDAWISSTVTPKMLNNFLAKSKMISLSECKIQFFSIAIGVTTECFLLATMAY DRYVAICKPLLYPAIMTNGLCIRLLILSYIAGILHALIHEGFLFRLTFCNSNIVHHIYCD TIPLSKISCTDSSINFLMVFIFSGSIQVFSIVTILISYTFVLFTVLEKKSDKGVRKAFST CGAHLFSVCLYYGPLLLMYVGPASPQADGQNMVEPLFYTVIIPLLNPIIYSLRNKQVIVS FIKMLKRNVKVSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRN2 (NM_001145023) Human Over-expression Lysate
LY428647 100 µg

SCRN2 (NM_001145023) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Hippocalcin (HPCA) activation kit by CRISPRa
GA102193 1 Kit

Human Hippocalcin (HPCA) activation kit by CRISPRa

Sign In for Pricing
View Details
OLFML2B Antibody
8G485-AAT 50 µg

OLFML2B Antibody

Sign In for Pricing
View Details
Stefin B (CSTB) Mouse Monoclonal Antibody [Clone ID: OTI2A7]
CF813048 100 µg

Stefin B (CSTB) Mouse Monoclonal Antibody [Clone ID: OTI2A7]

Sign In for Pricing
View Details
Recombinant Transferrin Antibody
RC-5429-01 50 μL

Recombinant Transferrin Antibody

Sign In for Pricing
View Details
Recombinant Transferrin Antibody
RC-5429-02 100 µL

Recombinant Transferrin Antibody

Sign In for Pricing
View Details