Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5D13 (OR5D13)

This Recombinant Human Olfactory receptor 5D13 (OR5D13) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 5D13, Olfactory receptor OR11-142, Olfactory receptor OR11-148

UniProt

Q8NGL4

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMASERNQSSTPTFILLGFSEYPEIQVPLFLVFLFVYTVTVVGNLGMIIIIRLNSKLHTI MCFFLSHLSLTDFCFSTVVTPKLLENLVVEYRTISFSGCIMQFCFACIFGVTETFMLAAM AYDRFVAVCKPLLYTTIMSQKLCALLVAGSYTWGIVCSLILTYFLLDLSFCESTFINNFI CDHSVIVSASYSDPYISQRLCFIIAIFNEVSSLIIILTSYMLIFTTIMKMRSASGRQKTF STCASHLTAITIFHGTILFLYCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDIN NMFEKLVVTKLIYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 450 Anti-human CD243 Antibody *UIC2*
12430041-AAT 500 Tests

IFluor® 450 Anti-human CD243 Antibody *UIC2*

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - AF633
BS21825-01 100 µL

Mouse Anti-Monkey IgG (H&L) - AF633

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - AF633
BS21825-02 500 µL

Mouse Anti-Monkey IgG (H&L) - AF633

Sign In for Pricing
View Details
Vom2r65 ORF Vector (Rat) (pORF)
ORF078974 1.0 µg DNA

Vom2r65 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Anti-NDUFS3 Rabbit pAb
GB111547-50 50 μL

Anti-NDUFS3 Rabbit pAb

Sign In for Pricing
View Details
Monkey Collagen Type I Alpha 1 (COL1A1) ELISA Kit
abx358958 96 Well

Monkey Collagen Type I Alpha 1 (COL1A1) ELISA Kit

Sign In for Pricing
View Details