Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5D13 (OR5D13)

This Recombinant Human Olfactory receptor 5D13 (OR5D13) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 5D13, Olfactory receptor OR11-142, Olfactory receptor OR11-148

UniProt

Q8NGL4

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMASERNQSSTPTFILLGFSEYPEIQVPLFLVFLFVYTVTVVGNLGMIIIIRLNSKLHTI MCFFLSHLSLTDFCFSTVVTPKLLENLVVEYRTISFSGCIMQFCFACIFGVTETFMLAAM AYDRFVAVCKPLLYTTIMSQKLCALLVAGSYTWGIVCSLILTYFLLDLSFCESTFINNFI CDHSVIVSASYSDPYISQRLCFIIAIFNEVSSLIIILTSYMLIFTTIMKMRSASGRQKTF STCASHLTAITIFHGTILFLYCVPNPKTSSLIVTVASVFYTVAIPMLNPLIYSLRNKDIN NMFEKLVVTKLIYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin 1 Polyclonal Antibody, FITC Conjugated
bs-11561R-FITC 100 µL

Gemin 1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Neuritin Recombinant Protein
92-259 0.05 mg

Neuritin Recombinant Protein

Sign In for Pricing
View Details
Mouse Nitric Oxide (NO) ELISA Kit
CK-bio-24628-01 48 Tests

Mouse Nitric Oxide (NO) ELISA Kit

Sign In for Pricing
View Details
Mouse Nitric Oxide (NO) ELISA Kit
CK-bio-24628-02 96 Tests

Mouse Nitric Oxide (NO) ELISA Kit

Sign In for Pricing
View Details
MTF-1 siRNA (h)
sc-43949 10 µM

MTF-1 siRNA (h)

Sign In for Pricing
View Details
USE1 Protein Vector (Human) (pPM-C-HA)
PV045403 500 ng

USE1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details