Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 478 (Olfr478)

This Recombinant Mouse Olfactory receptor 478 (Olfr478) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 478, Olfactory receptor 204-13

UniProt

Q8VG04

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFQEDGNHTAVTEFVLFGLTDDPVLRVILFIIFLCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLAFADIGYSSSVTPNMLVNFLVERHTISYIGCAIQLGSVVFFGSSECFILAA MAYDRFMAICNPLLYSTKMSTQVCVQLLLIAYIGGFLNTWSFTICFYSLVFCGPNGVNHF FCDFAPLIELSCSDVSVPATVPSFTAGSIIVVTVIVIAISYIYILITILKMHSTEGRQKA FSTCTSHLTAVTLFYGTITFIYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGALKRQIGRKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Human Recombinant Protein, Synthetic Nanodisc
TP721402M 100 µg

CD63 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Rnf123 3'UTR Luciferase Stable Cell Line
TU117952 1.0 mL

Rnf123 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Orai1 polyclonal antibody
BS90988 50ul

Orai1 polyclonal antibody

Sign In for Pricing
View Details
Riboflavin Impurity L
RM-R707212-01 10 mg

Riboflavin Impurity L

Sign In for Pricing
View Details
Riboflavin Impurity L
RM-R707212-02 25 mg

Riboflavin Impurity L

Sign In for Pricing
View Details
Riboflavin Impurity L
RM-R707212-03 50 mg

Riboflavin Impurity L

Sign In for Pricing
View Details