Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 478 (Olfr478)

This Recombinant Mouse Olfactory receptor 478 (Olfr478) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 478, Olfactory receptor 204-13

UniProt

Q8VG04

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFQEDGNHTAVTEFVLFGLTDDPVLRVILFIIFLCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLAFADIGYSSSVTPNMLVNFLVERHTISYIGCAIQLGSVVFFGSSECFILAA MAYDRFMAICNPLLYSTKMSTQVCVQLLLIAYIGGFLNTWSFTICFYSLVFCGPNGVNHF FCDFAPLIELSCSDVSVPATVPSFTAGSIIVVTVIVIAISYIYILITILKMHSTEGRQKA FSTCTSHLTAVTLFYGTITFIYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI KGALKRQIGRKIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human ACE2 Antibody (11B11), FITC
FHJ51611 100 Tests

Anti-Human ACE2 Antibody (11B11), FITC

Sign In for Pricing
View Details
ATXN7L2 Polyclonal Antibody, HRP Conjugated
bs-7976R-HRP 100 µL

ATXN7L2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Oseltamivir Impurity D
FE176653-01 10 mg

Oseltamivir Impurity D

Sign In for Pricing
View Details
Oseltamivir Impurity D
FE176653-02 25 mg

Oseltamivir Impurity D

Sign In for Pricing
View Details
Oseltamivir Impurity D
FE176653-03 50 mg

Oseltamivir Impurity D

Sign In for Pricing
View Details
Oseltamivir Impurity D
FE176653-04 100 mg

Oseltamivir Impurity D

Sign In for Pricing
View Details