Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 998 (Olfr998)

This Recombinant Mouse Olfactory receptor 998 (Olfr998) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 998, Olfactory receptor 175-5

UniProt

Q8VF76

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEKNQTIVMEFFFLGLTDHLYQKIALFITILFVYLVTLGGNLGMITLIWADPRLHTPMY FFLSHLSFVDMCSSSSIAPKMLCDIFAEEKRISFMGCAAQMWFFGFFVGTECFLLASMAY DRYTAICKPLLYTLLMSQRVCVHLVVGPYVFAIINITTHTTLAFCLPFCGSNTINHFFCD VSPLLSLACADSWVNKVVLFVLSGAIGVFSGLIIIVSYVSILMTIFKIQTADGKQKAFST CSSHLSAVSILYGTLFFIYVRPSASFSLNINKMISLFYTVVIPMLNPLIYSLRNKEVKGA FRRKVQKKHFPAGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig HRAb IgG ELISA Kit
EIA05812Gu 1 Kit

Guinea pig HRAb IgG ELISA Kit

Sign In for Pricing
View Details
MSTO1 Human qPCR Template Standard (NM_018116)
HK204925 1 Kit

MSTO1 Human qPCR Template Standard (NM_018116)

Sign In for Pricing
View Details
AIM2 Rabbit pAb, Pacific Blue conjugated
orb2852157 100 µL

AIM2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
CUL2 Immunizing Peptide
orb17557 100 µg

CUL2 Immunizing Peptide

Sign In for Pricing
View Details
DDX20 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV709214 1.0 µg DNA

DDX20 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
CRP Polyclonal Antibody, APC Conjugated
bs-0155R-APC-01 20 µL

CRP Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details