Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Chicken Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

P55167

Expression Region

1-314

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMLAPLRLVREPWNASEGNQSNATAGAGGAWCQGLDIPNELFLTLGLVSLVENLLVVAA ILKNRNLHSPTYYFICCLAVSDMLVSVSNLAKTLFMLLMEHGVLVIRASIVRHMDNVIDM LICSSVVSSLSFLGVIAVDRYITIFYALRYHSIMTLQRAVVTMASVWLASTVSSTVLITY YRNNAILLCLIGFFLFMLVLMLVLYIHMFALACHHVRSISSQQKQPTIYRTSSLKGAVTL TILLGVFFICWGPFFFHLILIVTCPTNPFCTCFFSYFNLFLILIICNSVVDPLIYAFRSQ ELRRTLREVVLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-500 1x 500 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106), CF568 conjugate, 0.1mg/mL
BNC680714-100 1x 100 µL

Thymidylate Synthase (TS106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details