Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

Q46LG5

Expression Region

1-315

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFQLNNFSFDPVVSLGFAAFLFLLMALPISFWAVAGSSDSSKARFLVAISNLFLTSQL ILRWWQSGHFPISNLYESLCFLTWGCTLAQLFLERAWRSPIVSAVATPVSLLSIGFASFV LPENLQSSAPLVPALRSSWLVMHVSVIMCSYAALLIGSILSFGVFLVDGKKQFNIRNSSF GSGSFRQSSELYLDERNENLNSIQPIEFTNAEQLDSLSYRSITAGFLLLTVGLISGAVWA NEAWGSWWSWDPKETWALICWLVYAAYLHTRITRGWQGKKPAILAIAGFFVIIVCYIGVN LLGVGLHSYGWFFDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zfp61 activation kit by CRISPRa
GA204717 1 Kit

Mouse Zfp61 activation kit by CRISPRa

Sign In for Pricing
View Details
CGB siRNA Oligos set (Human)
15997171 3x 5 nmol

CGB siRNA Oligos set (Human)

Sign In for Pricing
View Details
ODF4 sgRNA CRISPR Lentivector (Human) (Target 3)
K1476904 1.0 µg DNA

ODF4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MUC20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1368105 3x 1.0 µg

MUC20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
YTHDF2 HDR Plasmid (h)
sc-416408-HDR 20 µg

YTHDF2 HDR Plasmid (h)

Sign In for Pricing
View Details
Canine Phosphofructokinase ELISA Kit
MBS7262179-01 48 Well

Canine Phosphofructokinase ELISA Kit

Sign In for Pricing
View Details