Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

Q46LG5

Expression Region

1-315

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFQLNNFSFDPVVSLGFAAFLFLLMALPISFWAVAGSSDSSKARFLVAISNLFLTSQL ILRWWQSGHFPISNLYESLCFLTWGCTLAQLFLERAWRSPIVSAVATPVSLLSIGFASFV LPENLQSSAPLVPALRSSWLVMHVSVIMCSYAALLIGSILSFGVFLVDGKKQFNIRNSSF GSGSFRQSSELYLDERNENLNSIQPIEFTNAEQLDSLSYRSITAGFLLLTVGLISGAVWA NEAWGSWWSWDPKETWALICWLVYAAYLHTRITRGWQGKKPAILAIAGFFVIIVCYIGVN LLGVGLHSYGWFFDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grm6 siRNA Oligos set (Rat)
22696176 3x 5 nmol

Grm6 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Insect Protein Extraction Kit
EX1140-01 10 Tests

Insect Protein Extraction Kit

Sign In for Pricing
View Details
Insect Protein Extraction Kit
EX1140-02 50 Tests

Insect Protein Extraction Kit

Sign In for Pricing
View Details
Insect Protein Extraction Kit
EX1140-03 100 Tests

Insect Protein Extraction Kit

Sign In for Pricing
View Details
Spats2 siRNA Oligos set (Mouse)
45239174 3x 5 nmol

Spats2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Cytochrome C Oxidase Subunit I (COX1) Magnetic Fluorescence Assay Kit
MBS2159261-01 96 Tests

Cytochrome C Oxidase Subunit I (COX1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details