Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

Q46LG5

Expression Region

1-315

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDFQLNNFSFDPVVSLGFAAFLFLLMALPISFWAVAGSSDSSKARFLVAISNLFLTSQL ILRWWQSGHFPISNLYESLCFLTWGCTLAQLFLERAWRSPIVSAVATPVSLLSIGFASFV LPENLQSSAPLVPALRSSWLVMHVSVIMCSYAALLIGSILSFGVFLVDGKKQFNIRNSSF GSGSFRQSSELYLDERNENLNSIQPIEFTNAEQLDSLSYRSITAGFLLLTVGLISGAVWA NEAWGSWWSWDPKETWALICWLVYAAYLHTRITRGWQGKKPAILAIAGFFVIIVCYIGVN LLGVGLHSYGWFFDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPC142 (BABAM1) Human Over-expression Lysate
orb1347859 100 µg

HSPC142 (BABAM1) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Carbohydrate Sulfotransferase 3/CHST3 Antibody [HRP]
NBP2-98311H 0.1 mL

Rabbit Polyclonal Carbohydrate Sulfotransferase 3/CHST3 Antibody [HRP]

Sign In for Pricing
View Details
VPS37C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2619306 1.0 µg DNA

VPS37C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Raphin1 acetate 100mg
A21373-100 100 mg

Raphin1 acetate 100mg

Sign In for Pricing
View Details
Ethoxyquin (EQ) ELISA Kit
EKF1014 96 Tests

Ethoxyquin (EQ) ELISA Kit

Sign In for Pricing
View Details
Aurora B (STK12, Serine Threonine Kinase 12, Aurora Kinase B, AIK2, AIM1, AurB, IPL1, ARK2, Aurora Related Kinase 2)
MBS617109-01 0.1 mg

Aurora B (STK12, Serine Threonine Kinase 12, Aurora Kinase B, AIK2, AIM1, AurB, IPL1, ARK2, Aurora Related Kinase 2)

Sign In for Pricing
View Details