Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-48 (srd-48)

This Recombinant Serpentine receptor class delta-48 (srd-48) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-48, Protein srd-48

UniProt

O17822

Expression Region

1-316

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYGEILSFFYITFFILVLPTQIFGIFVILRFSTKHLKLWKKFLLCNLICQIISVATLCLL QLRQVSNLSPMEIWCYGPIRHFSAITSYLFYVLSQISTLMTYFLVFITIYLKYEAVKNVN KQNYRKVVIILMLLLPIFITMVAQIDLMIVFFSPNEAQKKFNELNAIITDHSVIGYVISG RISSFLLTVIIFGSVFLLPPAGFFIRKKIIRCINSTSDSASVGQKFQRRSFINGLTLQSF LPLVCICPIFACYFVVSRTKTDLPFEQHILPVLVMLPTLFDPYIILYSVTPYRKQIRTWL GMTKTVPMVIVASVMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTF3 (NM_001037637) Human Over-expression Lysate
LC421972 20 µg

BTF3 (NM_001037637) Human Over-expression Lysate

Sign In for Pricing
View Details
LAMP1 Mouse Monoclonal Antibody [Clone ID: B-T47]
AM03025PU-N 2 mL (200 Tests)

LAMP1 Mouse Monoclonal Antibody [Clone ID: B-T47]

Sign In for Pricing
View Details
3-Nitrophthalic Anhydride
TRC-N515320-5G 5 g

3-Nitrophthalic Anhydride

Sign In for Pricing
View Details
Tissue FFPE Sections, Muscle tissue
CS801138 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS805176 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), CF405S conjugate, 0.1mg/mL
BNC041882-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details