Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-48 (srd-48)

This Recombinant Serpentine receptor class delta-48 (srd-48) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-48, Protein srd-48

UniProt

O17822

Expression Region

1-316

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYGEILSFFYITFFILVLPTQIFGIFVILRFSTKHLKLWKKFLLCNLICQIISVATLCLL QLRQVSNLSPMEIWCYGPIRHFSAITSYLFYVLSQISTLMTYFLVFITIYLKYEAVKNVN KQNYRKVVIILMLLLPIFITMVAQIDLMIVFFSPNEAQKKFNELNAIITDHSVIGYVISG RISSFLLTVIIFGSVFLLPPAGFFIRKKIIRCINSTSDSASVGQKFQRRSFINGLTLQSF LPLVCICPIFACYFVVSRTKTDLPFEQHILPVLVMLPTLFDPYIILYSVTPYRKQIRTWL GMTKTVPMVIVASVMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (ASTRO/789), CF568 conjugate, 0.1mg/mL
BNC680789-500 1x 500 µL

GFAP (ASTRO/789), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF594 conjugate, 0.1mg/mL
BNC942259-500 1x 500 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody
E-AB-21027-01 20 µL

Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody
E-AB-21027-02 60 µL

Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody
E-AB-21027-03 120 µL

Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody
E-AB-21027-04 200 µL

Phospho-P38 (Thr180/Tyr182) Polyclonal Antibody

Sign In for Pricing
View Details