Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio hamadryas Taste receptor type 2 member 7 (TAS2R7)

This Recombinant Papio hamadryas Taste receptor type 2 member 7 (TAS2R7) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 7, T2R7

UniProt

Q646F6

Expression Region

1-317

Origin

Papio hamadryas (Hamadryas baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDKVQTTLLFLAIGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFMLVLYPDVYATGKQMRIIDFFWTLTNHLSIWFATCLSIYYFFKIANFFHPLFL WMKWRIDRVISWILLGCMVLSVFINLPATENLNADFRRCVKAKRKTNLTWSCRVTKAQHA STKLFLNLVTLLPFSVCLVSFFLLILSLWRHIRRMQLSATGCRDPSTEAHVRALKAVISF LFLFIAYYLSFLIATSSYFIPETELAVIFGEFIALIYPSSHSFILILGNNKLRRASLKVL WTVMSILKGRKFQQKQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-500 1x 500 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-500 1x 500 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), 0.2mg/mL
BNUB0333-100 1x 100 µL

CD8 (RIV11), 0.2mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details