Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein lifeguard 2 (Faim2)

This Recombinant Mouse Protein lifeguard 2 (Faim2) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Protein lifeguard 2, Fas apoptotic inhibitory molecule 2, Neural membrane protein 35

UniProt

Q8K097

Expression Region

1-317

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSGEGLKAGTFPQGPTAV PLHPSWAYVDPSGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLA VVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSM AYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGL LLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD IIYIFTFFLQLFGTNRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shaker 15 Kg SS Clamp 1 No, 150 ml
100S01501SC015 1 Unit

Shaker 15 Kg SS Clamp 1 No, 150 ml

Sign In for Pricing
View Details
COL6A3 ORF Vector (Human) (pORF)
16591011 1.0 µg DNA

COL6A3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Polyclonal Rabbit Histidine Decarboxylase Antibody
orb303090 50 μl (lyoph)

Polyclonal Rabbit Histidine Decarboxylase Antibody

Sign In for Pricing
View Details
Ang5 (NM_007448) Mouse Tagged ORF Clone
MG215105 10 µg

Ang5 (NM_007448) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ADRM1 (NM_175573) Human Tagged ORF Clone
RC205671 10 µg

ADRM1 (NM_175573) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Interleukin 1 Receptor Associated Kinase 2,IRAK2 ELISA KIT
JOT-EK0756Mo-01 96 Well

Mouse Interleukin 1 Receptor Associated Kinase 2,IRAK2 ELISA KIT

Sign In for Pricing
View Details