Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein lifeguard 2 (Faim2)

This Recombinant Mouse Protein lifeguard 2 (Faim2) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Protein lifeguard 2, Fas apoptotic inhibitory molecule 2, Neural membrane protein 35

UniProt

Q8K097

Expression Region

1-317

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSGEGLKAGTFPQGPTAV PLHPSWAYVDPSGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLA VVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSM AYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGL LLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD IIYIFTFFLQLFGTNRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TST (NM_003312) Human Tagged ORF Clone Lentiviral Particle
RC204002L4V 200 µL

TST (NM_003312) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Susd3 3'UTR GFP Stable Cell Line
TU271423 1.0 mL

Susd3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human CEBPA / CCAAT/Enhancer-Binding Protein alpha Recombinant Protein
MBS2901916 Inquire

Human CEBPA / CCAAT/Enhancer-Binding Protein alpha Recombinant Protein

Sign In for Pricing
View Details
Procalcitonin (PCT) Antibody
abx021243 1 mg

Procalcitonin (PCT) Antibody

Sign In for Pricing
View Details
RAMP3 Rabbit Polyclonal Antibody
MBS9516506-01 0.05 mL

RAMP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAMP3 Rabbit Polyclonal Antibody
MBS9516506-02 0.1 mL

RAMP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details