Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6N2 (OR6N2)

This Recombinant Human Olfactory receptor 6N2 (OR6N2) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor 6N2, Olfactory receptor OR1-23

UniProt

Q8NGY6

Expression Region

1-317

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQYNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMY HFVSVLSFLELWYTATTIPKMLSNILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAY DRYLAICRPLHYPIIMTTTLCAKMAAACWTCGFLCPISEVILASQLPFCAYNEIQHIFCD FPPLLSLACKDTSANILVDFAINAFIILITFFFIMISYARIIGAVLKIKTASGRKKAFST CASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKA IKRTIFQKGDKASLAHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF1 (NRF1/2609), CF568 conjugate, 0.1mg/mL
BNC682609-100 1x 100 µL

NRF1 (NRF1/2609), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF647 conjugate, 0.1mg/mL
BNC472791-100 1x 100 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CTAG2 (NM_172377) Human Recombinant Protein
TP311659L 1 mg

CTAG2 (NM_172377) Human Recombinant Protein

Sign In for Pricing
View Details
Rtn4rl1 Mouse Gene Knockout Kit (CRISPR)
KN515194 1 Kit

Rtn4rl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAT8 (NM_003960) Human Over-expression Lysate
LC401303 20 µg

NAT8 (NM_003960) Human Over-expression Lysate

Sign In for Pricing
View Details
BCA Protein Dual Range Colorimetric Detection Kit
K041-H1 2 Plates

BCA Protein Dual Range Colorimetric Detection Kit

Sign In for Pricing
View Details