Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vomeronasal type-1 receptor 45 (Vmn1r45)

This Recombinant Mouse Vomeronasal type-1 receptor 45 (Vmn1r45) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor 45, Pheromone receptor 2, Vomeronasal type-1 receptor A2, mV1R2, Vomeronasal type-1 receptor A9

UniProt

Q8VIC7

Expression Region

1-318

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEILFFSPQPLFSHMMNKNSRLHTHSNIKNTFFSEIGIGILGNSFLLLFHILKFIRGHR LRLTDLPIGLLSLIHLLMLLLMAFIATDIFISRRGWDDIICKFLVYLYRVLRGLSLCTTS MLSVLQAIILSPRSSCLAKLKHKYPHHISCAIIFLSVLYMLISSHILLSIIATPNLTRND FLYVTQSCSILPLSYVMQSMYSTLLALREVFLISLMVLSTLYMVVLLCRHRKQAQHLQGT SLSPKASAEQRATQTILMLMTFFVLMSIFDSIVSCSRTMFLDDPTSYSIHIFVMHIYATV SPFVFMSTEKHIVNILRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-500 1x 500 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF647 conjugate, 0.1mg/mL
BNC472990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF647 conjugate, 0.1mg/mL
BNC472053-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details