Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSP94/MSMB, Human (His)

PSP94/MSMB protein forms homodimers and interacts with PI16. PSP94/MSMB Protein, Human (His) is the recombinant human-derived PSP94/MSMB protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

PSP94/MSMB Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psp94-msmb-protein-human-his.html

Purity

91.00

Smiles

SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Molecular Formula

4477 (Gene_ID) P08118-1 (S21-I114) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmocollin 1 Recombinant Rabbit Monoclonal Antibody [JE66-57]
HA721418 100 µL

Desmocollin 1 Recombinant Rabbit Monoclonal Antibody [JE66-57]

Sign In for Pricing
View Details
PR3 (PRTN3) Mouse Monoclonal Antibody [Clone ID: OTI5B8]
CF807274 100 µg

PR3 (PRTN3) Mouse Monoclonal Antibody [Clone ID: OTI5B8]

Sign In for Pricing
View Details
MST1L Human Gene Knockout Kit (CRISPR)
KN434721 1 Kit

MST1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BCL2L13 Antibody
KC-3716-01 50 μL

BCL2L13 Antibody

Sign In for Pricing
View Details
BCL2L13 Antibody
KC-3716-02 100 µL

BCL2L13 Antibody

Sign In for Pricing
View Details
BCL2L13 Antibody
KC-3716-03 1 mL

BCL2L13 Antibody

Sign In for Pricing
View Details