Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSP94/MSMB, Human (His)

PSP94/MSMB protein forms homodimers and interacts with PI16. PSP94/MSMB Protein, Human (His) is the recombinant human-derived PSP94/MSMB protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

PSP94/MSMB Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psp94-msmb-protein-human-his.html

Purity

91.00

Smiles

SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Molecular Formula

4477 (Gene_ID) P08118-1 (S21-I114) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), CF647 conjugate, 0.1mg/mL
BNC473245-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apigenin-7-O-sulfate Potassium Salt
TRC-A726520-25MG 25 mg

Apigenin-7-O-sulfate Potassium Salt

Sign In for Pricing
View Details
Human CYRIA activation kit by CRISPRa
GA113060 1 Kit

Human CYRIA activation kit by CRISPRa

Sign In for Pricing
View Details
EPS15L1 Antibody
KC-31918-01 50 μL

EPS15L1 Antibody

Sign In for Pricing
View Details
EPS15L1 Antibody
KC-31918-02 100 µL

EPS15L1 Antibody

Sign In for Pricing
View Details
EPS15L1 Antibody
KC-31918-03 1 mL

EPS15L1 Antibody

Sign In for Pricing
View Details