Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSP94/MSMB, Human (His)

PSP94/MSMB protein forms homodimers and interacts with PI16. PSP94/MSMB Protein, Human (His) is the recombinant human-derived PSP94/MSMB protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

PSP94/MSMB Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psp94-msmb-protein-human-his.html

Purity

91.00

Smiles

SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Molecular Formula

4477 (Gene_ID) P08118-1 (S21-I114) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5AK2 3'UTR Lenti-reporter-Luc Vector
35380081 1.0 µg

OR5AK2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MCP100-ST-IN-5Y Training Services
323144 1 Pack (1 Piece (s) x 1 Piece)

MCP100-ST-IN-5Y Training Services

Sign In for Pricing
View Details
Cxcr3 Rat Pre-designed siRNA Set A
HY-RS03405 1 Set

Cxcr3 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Alpha-cobratoxin Protein, Naja kaouthia, Recombinant (GST & His & Myc)
TMPH-03037-01 5 µg

Alpha-cobratoxin Protein, Naja kaouthia, Recombinant (GST & His & Myc)

Sign In for Pricing
View Details
Alpha-cobratoxin Protein, Naja kaouthia, Recombinant (GST & His & Myc)
TMPH-03037-02 10 µg

Alpha-cobratoxin Protein, Naja kaouthia, Recombinant (GST & His & Myc)

Sign In for Pricing
View Details
Alpha-cobratoxin Protein, Naja kaouthia, Recombinant (GST & His & Myc)
TMPH-03037-03 20 µg

Alpha-cobratoxin Protein, Naja kaouthia, Recombinant (GST & His & Myc)

Sign In for Pricing
View Details