Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Taste receptor type 2 member 7 (TAS2R7)

This Recombinant Pan troglodytes Taste receptor type 2 member 7 (TAS2R7) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 7, T2R7

UniProt

Q646C4

Expression Region

1-319

Origin

Pan troglodytes (Chimpanzee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYXFRIANFFHPLFL WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLVATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI WKVMSILKGRKFQQHKQIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL
BNC941223-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF740 conjugate, 0.1mg/mL
BNC740667-100 1x 100 µL

CD1a (O10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (p120) (CTNNB1/2099), CF594 conjugate, 0.1mg/mL
BNC942099-500 1x 500 µL

Catenin, beta (p120) (CTNNB1/2099), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF488A conjugate, 0.1mg/mL
BNC881920-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details