Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein lifeguard 3 (Tmbim1)

This Recombinant Mouse Protein lifeguard 3 (Tmbim1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Protein lifeguard 3, Responsive to centrifugal force and shear stress gene 1 protein, Protein RECS1, Transmembrane BAX inhibitor motif-containing protein 1

UniProt

Q8BJZ3

Expression Region

1-309

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNPSAPPPYEDHNPLYPGSPPPGGYGQPSVLPGGYPAYPAYPQPGYGHPAGYPQPVPPV HPMPMNYGHDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCIISVQLLITVAIIAIFTF VEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWDIILLTIFTLALGFVTGTI SSMYENKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSIVLI FKYIYWLHMVYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIVYIFTF VLQLVGSRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL5 Polyclonal Antibody
MBS9235971-01 0.1 mL

KLHL5 Polyclonal Antibody

Sign In for Pricing
View Details
KLHL5 Polyclonal Antibody
MBS9235971-02 5x 0.1 mL

KLHL5 Polyclonal Antibody

Sign In for Pricing
View Details
(3R) -3-hydroxy-5-oxo-1-piperidinecarboxylic Acid 1,1-Dmethylethyl Ester
428023-01 10 mg

(3R) -3-hydroxy-5-oxo-1-piperidinecarboxylic Acid 1,1-Dmethylethyl Ester

Sign In for Pricing
View Details
(3R) -3-hydroxy-5-oxo-1-piperidinecarboxylic Acid 1,1-Dmethylethyl Ester
428023-02 50 mg

(3R) -3-hydroxy-5-oxo-1-piperidinecarboxylic Acid 1,1-Dmethylethyl Ester

Sign In for Pricing
View Details
Pentedrone hydrochloride
EKB66995-01 10 mg

Pentedrone hydrochloride

Sign In for Pricing
View Details
Pentedrone hydrochloride
EKB66995-02 25 mg

Pentedrone hydrochloride

Sign In for Pricing
View Details