Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 183 (Olfr183)

This Recombinant Mouse Olfactory receptor 183 (Olfr183) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 183, Olfactory receptor 183-2

UniProt

Q8VFB9

Expression Region

1-309

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKNETLWTEFVLTGLTCLPQWKPLLFLVFLVIYFMTIVGNLGLITLIWNDPHLHIPMY LFLSNLAFVDTWLSSTVTPRMLFNLLDKGKVISVAECKTQFFSFAISVTTECFLLAAMAY DRYAAICNPLLYPVIMTNRLCVRLLALSFIGGFLHAVIHESFLSRLTFCNSNIIYHFYCD VIPLLKISCTDPSLNYLIIFIFSGSIQVFTIMTVLISYTFVLFTILKKKSDKGIRKAFST CGAHLLSVSLYYGPLLFMYVHPASSEVDDQDMILSLFYTVIIPVLNPIIYSLRNKQVIDS LKKMLKMMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPANK1 CRISPR Knock Out 293T Cell Line (Human)
22435141 1x 10^6 Cells / 1.0 mL

GPANK1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
DNAJC17 antibody
70R-32162 0.1 mg

DNAJC17 antibody

Sign In for Pricing
View Details
Mouse Monoclonal human Crk Antibody
orb1409485-01 100 µg

Mouse Monoclonal human Crk Antibody

Sign In for Pricing
View Details
Mouse Monoclonal human Crk Antibody
orb1409485-02 50 µg

Mouse Monoclonal human Crk Antibody

Sign In for Pricing
View Details
Ncr3 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7423102 1.0 µg DNA

Ncr3 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Porcine BTB/POZ domain containing protein 1 (BTBD1) ELISA Kit
GTR10353519 96 Well

Porcine BTB/POZ domain containing protein 1 (BTBD1) ELISA Kit

Sign In for Pricing
View Details