Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 183 (Olfr183)

This Recombinant Mouse Olfactory receptor 183 (Olfr183) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 183, Olfactory receptor 183-2

UniProt

Q8VFB9

Expression Region

1-309

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKNETLWTEFVLTGLTCLPQWKPLLFLVFLVIYFMTIVGNLGLITLIWNDPHLHIPMY LFLSNLAFVDTWLSSTVTPRMLFNLLDKGKVISVAECKTQFFSFAISVTTECFLLAAMAY DRYAAICNPLLYPVIMTNRLCVRLLALSFIGGFLHAVIHESFLSRLTFCNSNIIYHFYCD VIPLLKISCTDPSLNYLIIFIFSGSIQVFTIMTVLISYTFVLFTILKKKSDKGIRKAFST CGAHLLSVSLYYGPLLFMYVHPASSEVDDQDMILSLFYTVIIPVLNPIIYSLRNKQVIDS LKKMLKMMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T4 Polynucleotide kinase (10 U/μL)
12902ES92 10000 U

T4 Polynucleotide kinase (10 U/μL)

Sign In for Pricing
View Details
RPL39P32 CRISPRa sgRNA lentivector (set of three targets)(Human)
41672121 3x 1.0µg DNA

RPL39P32 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Human TNFa/TNF-alpha Protein, N-His
HF879011-01 50 µg

Recombinant Human TNFa/TNF-alpha Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TNFa/TNF-alpha Protein, N-His
HF879011-02 100 µg

Recombinant Human TNFa/TNF-alpha Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TNFa/TNF-alpha Protein, N-His
HF879011-03 1 mg

Recombinant Human TNFa/TNF-alpha Protein, N-His

Sign In for Pricing
View Details
Anti-H9 (A/Hong Kong/2108/03) (H9N2)
IT-003-0093M4-01 0.1 mg

Anti-H9 (A/Hong Kong/2108/03) (H9N2)

Sign In for Pricing
View Details