Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C46 (OR4C46)

This Recombinant Human Olfactory receptor 4C46 (OR4C46) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 4C46

UniProt

A6NHA9

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENRNNMTEFVLLGLTENPKMQKIIFVVFFVIYIITVVGYVLIVVTITASPSLGSPMYLS LAYLSFIDACYSSVNTPNLITHSLYGKKAILFNGCMTQVFGEHFFGGAEGILLTVMAYDH YVAICKPLHYMTIMNQCVCALLMGVVWMGGFLHATIQILFIFQLPFCGPNVIDHFMCDLN PLLNLACTDTHMLELFIAANSGFICLLNFALLLVSYVVILCSLRTHSLEARHKALSTCVS HITVVILFFVPCIFVYMRPAATLPIDKAVAIFYTMITPMLNPLIYTLKNAQMKNAIRKLC SRKDISGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P14ARF (4C6/4), CF405S conjugate, 0.1mg/mL
BNC042088-100 1x 100 µL

P14ARF (4C6/4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dry Bath Incubator BDIB-105
BDIB-105 1 Unit

Dry Bath Incubator BDIB-105

Sign In for Pricing
View Details
Recombinant RIP Monoclonal Antibody
AN301086L-01 50 µL

Recombinant RIP Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant RIP Monoclonal Antibody
AN301086L-02 100 µL

Recombinant RIP Monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD39 Antibody[A1]
E-AB-F1165M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD39 Antibody[A1]
E-AB-F1165M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details