Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10G2 (OR10G2)

This Recombinant Human Olfactory receptor 10G2 (OR10G2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 10G2

UniProt

Q8NGC3

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKTKNTSLDAVVTDFILLGLSHPPNLRSLLFLVFFIIYILTQLGNLLILLTMWADPKLC ARPMYILLGVLSFLDMWLSSVTVPRLILDFTPSIKAIPFGGCVAQLYFFHFLGSTQCFLY TLMAYDRYLAICQPLHYPVLMNGRLCTVLVAGAWVAGSMHGSIQATLTFRLPYCGPNQVD YFICDIRAVLRLACADTTVNELVTFVDVRVVAASCFMLILLSYANIVHAILKIRTADGRR RAFSTCGSHLIVVTVYYVPCIFIYLRAGSKDPLDGAAAVFYTVVTPLLNPLIYTLRNQEV KSALKRITAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Murine Beta Defensin 3 
(rMuBD-3)
JOT-PR2011 5µg

Recombinant Murine Beta Defensin 3 (rMuBD-3)

Sign In for Pricing
View Details
Recombinant Human FGFR3/ CD333 Protein, His-B2M, E.coli-1mg
QP6047-ec-1mg 1mg

Recombinant Human FGFR3/ CD333 Protein, His-B2M, E.coli-1mg

Sign In for Pricing
View Details
Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)
TRV-0062074-01 20 µL

Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)
TRV-0062074-02 100 µL

Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)
TRV-0062074-03 200 µL

Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)
TRV-0062074-04 1 mL

Polyclonal Antibody to Ribosome Binding Protein 1 (RRBP1)

Sign In for Pricing
View Details