Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 7A2 (OR7A2P)

This Recombinant Human Putative olfactory receptor 7A2 (OR7A2P) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Putative olfactory receptor 7A2, Putative olfactory receptor 7A7

UniProt

Q8NGA2

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKAGNETQISEFLLLGFSEKQELQPFLFGLFLSMYLVTVLGNLLIILAAISDSCLHTPM YFFLSNLSFVDICFASTMVPKMLVNIQTQSKVITYAGCITQMCFFVLFIVLDSLLLTVMA YDQFVAICHPLHYTVIMSPQLCGLLVLVSWIMSVLNSMLQSLVTLQLSFCTDLEIPHFFC ELNEMIHLACSDTFVNNMVMHFAAVLLDGGPLVGILYSYCRIVSSIRAISSTQGKYKALS TCASHLSVVSIFYGTGLGVYLSSTMTQNLHSTAVASVMYTVVTPMLNPFIYSLRNKDIKG ALTQFFRGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GPR158 Antibody
NBP2-82932-0.1mL 0.1 mL

Rabbit Polyclonal GPR158 Antibody

Sign In for Pricing
View Details
Anti-Mitochondrial Pyruvate dehydrogenase kinase 1/PDK1 Antibody Picoband® Fluoro647 Conjugated
A01268-1-Fluoro647 100 µg/Vial

Anti-Mitochondrial Pyruvate dehydrogenase kinase 1/PDK1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Human Nesprin 1 (Nesp1) ELISA Kit
QY-E04774 96 Tests

Human Nesprin 1 (Nesp1) ELISA Kit

Sign In for Pricing
View Details
Rossicaside B
orb1680477 5 mg

Rossicaside B

Sign In for Pricing
View Details
DLL3, CT (DLL3, Delta-like protein 3, Drosophila Delta homolog 3) (Biotin) discontinued
034668-Biotin 200 µL

DLL3, CT (DLL3, Delta-like protein 3, Drosophila Delta homolog 3) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Dgkq Pre-designed siRNA Set A
SI103601A 1 Each

Mouse Dgkq Pre-designed siRNA Set A

Sign In for Pricing
View Details