Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 13 (Olfr13)

This Recombinant Mouse Olfactory receptor 13 (Olfr13) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 13, Odorant receptor K7, Olfactory receptor 261-6

UniProt

P34984

Expression Region

1-310

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNNMTLITEFILLGFPLSPRMQMLLFALFSLFYAFTLLGNGTIVGLICLDSRLHTPMYF FLSHLAIVDIAYACNTVPQMLVNLLDPVKPISYAGCMTQTFLFLTFAITECLLLVVMSYD RYVAICHPLRYSAIMSWRVCSTMAVTSWIIGVLLSLIHLVLLLPLPFCVSQKVNHFFCEI TAILKLACADTHLNETMVLAGAVSVLVGPFSSIVVSYACILGAILKIQSEEGQRKAFSTC SSHLCVVGLFYGTAIVMYVGPRHGSPKEQKKYLLLFHSLFNPMLNPLIYSLRNSDVKNTL KRVLRTQRAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf142 (GON7) Human Gene Knockout Kit (CRISPR)
KN206178LP 1 Kit

C14orf142 (GON7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D6]
TA502739AM 100 µL

STAT5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D6]

Sign In for Pricing
View Details
Mouse Fzd8 activation kit by CRISPRa
GA201499 1 Kit

Mouse Fzd8 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Anti-Human CD73 Antibody[AD2]
E-AB-F1242C-01 20 Tests

FITC Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
FITC Anti-Human CD73 Antibody[AD2]
E-AB-F1242C-02 100 Tests

FITC Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
FITC Anti-Human CD73 Antibody[AD2]
E-AB-F1242C-03 2x 100 Tests

FITC Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details