Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 125 (Tas2r125)

This Recombinant Mouse Taste receptor type 2 member 125 (Tas2r125) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 125, T2R125, mT2R59

UniProt

Q7M710

Expression Region

1-311

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGIAIDILWAAIIIVQFIIGNIANGFIALVNIIDWVKRRKISLMDKIITALAISRIYLL WSTFLITLTSSLDPDIKMAVKIIRISNNTWIIANHFSIWFATCLSIFYFLKIANFSNYIF LYLRWRFKKVVSVTLLISLIFLLLNILLMNMHIDIWSDKSKRNLSFSVRSNNCTQFPRLV LLINTMFTSIPFTVSLLAFLLLIFSLWRHLKTMQYYAKGSEDTTTAAHIKALHMVVAFLL FYTVFFLSLAIQYWTSGSQENNNLFYATIVITFPSVHSCILILRNSQLRQASLLVLWWLL CKSKDVRMLVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-100 1x 100 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-500 1x 500 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-100 1x 100 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details