Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5M8 (OR5M8)

This Recombinant Human Olfactory receptor 5M8 (OR5M8) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Olfactory receptor 5M8, Olfactory receptor OR11-194

UniProt

Q8NGP6

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRNCTLVTEFILLGLTSRRELQILLFTLFLAIYMVTVAGNLGMIVLIQANAWLHMPMYF FLSHLSFVDLCFSSNVTPKMLEIFLSEKKSISYPACLVQCYLFIALVHVEIYILAVMAFD RYMAICNPLLYGSRMSKSVCSFLITVPYVYGALTGLMETMWTYNLAFCGPNEINHFYCAD PPLIKLACSDTYNKELSMFIVAGWNLSFSLFIICISYLYIFPAILKIRSTEGRQKAFSTC GSHLTAVTIFYATLFFMYLRPPSKESVEQGKMVAVFYTTVIPMLNLIIYSLRNKNVKEAL IKELSMKIYFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EPRS1/PARS Antibody Picoband®, FITC Conjugate
A02967-2-FITC 100 µg/Vial

Anti-EPRS1/PARS Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
CLCC1 Rabbit pAb
orb2715335-01 50 µL

CLCC1 Rabbit pAb

Sign In for Pricing
View Details
CLCC1 Rabbit pAb
orb2715335-02 100 µL

CLCC1 Rabbit pAb

Sign In for Pricing
View Details
Annexin A10
orb1643842-01 50 µg

Annexin A10

Sign In for Pricing
View Details
Annexin A10
orb1643842-02 100 µg

Annexin A10

Sign In for Pricing
View Details
Annexin A10
orb1643842-03 1 mg

Annexin A10

Sign In for Pricing
View Details