Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-31 (srg-31)

This Recombinant Serpentine receptor class gamma-31 (srg-31) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-31, Protein srg-31

UniProt

O61892

Expression Region

1-312

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSSLLITQFIYGTISTIIYSLTVVFLTKNWKHFDNYFLKLYICQFFFNMWMYWNFYITS RLPASTCKDCYLSGWFDSLSKDSGSMFPFKFFIFCQYHLGFMSYSNLFLTSINRFTLIFM PKRYFQIWHYGTYILIALIFITPILFTYPLLVHQAYLEYNPLSDTYVARTQADLPFLYSF ILVWMVVTVLLSIIANIICWFKISKYSKAARQQSDYRLFLVSFVTFVINCGVFSIAMLNK ISADIDPSKLLLSSRIAQLLSPFANDLLSLSTPYVLIIFSKRIRQSIKNLFIKGTVAPSS ITPLQNIPASRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]
TA500379BM 100 µL

SIGLEC9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]

Sign In for Pricing
View Details
Sumo 2 (SUMO2) (NM_001005849) Human Over-expression Lysate
LC423659 20 µg

Sumo 2 (SUMO2) (NM_001005849) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Hydroxybutyrylcarnitine Chloride
TRC-H830900-5MG 5 mg

3-Hydroxybutyrylcarnitine Chloride

Sign In for Pricing
View Details
Abcd4 Mouse Gene Knockout Kit (CRISPR)
KN500634 1 Kit

Abcd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Rat NGF (Nerve Growth Factor) ELISA Kit
E-UNEL-R0013-01 5x 96 Tests

Uncoated Rat NGF (Nerve Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat NGF (Nerve Growth Factor) ELISA Kit
E-UNEL-R0013-02 15x 96 Tests

Uncoated Rat NGF (Nerve Growth Factor) ELISA Kit

Sign In for Pricing
View Details