Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-31 (srg-31)

This Recombinant Serpentine receptor class gamma-31 (srg-31) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-31, Protein srg-31

UniProt

O61892

Expression Region

1-312

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSSLLITQFIYGTISTIIYSLTVVFLTKNWKHFDNYFLKLYICQFFFNMWMYWNFYITS RLPASTCKDCYLSGWFDSLSKDSGSMFPFKFFIFCQYHLGFMSYSNLFLTSINRFTLIFM PKRYFQIWHYGTYILIALIFITPILFTYPLLVHQAYLEYNPLSDTYVARTQADLPFLYSF ILVWMVVTVLLSIIANIICWFKISKYSKAARQQSDYRLFLVSFVTFVINCGVFSIAMLNK ISADIDPSKLLLSSRIAQLLSPFANDLLSLSTPYVLIIFSKRIRQSIKNLFIKGTVAPSS ITPLQNIPASRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YIL 781
TRC-Y100650-25MG 25 mg

YIL 781

Sign In for Pricing
View Details
Human GPR152 activation kit by CRISPRa
GA118137 1 Kit

Human GPR152 activation kit by CRISPRa

Sign In for Pricing
View Details
BCAS2 (NM_005872) Human Recombinant Protein
TP720563L 500 µg

BCAS2 (NM_005872) Human Recombinant Protein

Sign In for Pricing
View Details
N-Butylscopolammonium Bromide
TRC-B693750-5G 5 g

N-Butylscopolammonium Bromide

Sign In for Pricing
View Details
Bis(3-Aminophenyl) Sulfone
TRC-B405520-50G 50 g

Bis(3-Aminophenyl) Sulfone

Sign In for Pricing
View Details
Her2 (ERBB2) Rabbit Polyclonal Antibody
AP20517PU-N 100 µg

Her2 (ERBB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details