Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 135 (Tas2r135)

This Recombinant Mouse Taste receptor type 2 member 135 (Tas2r135) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 135, T2R135, Taste receptor type 2 member 35, T2R35, mT2r38

UniProt

Q7TQA9

Expression Region

1-312

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTGHTVLGCQTTDKTVVTLFIILVLLCLVAVVGNGFIIIALGMKWLLRRTLSAHNKLLI SLAASRFCLQCVVIGKNIYVFLNPTSFPYNPVIQLLNLMWDFLTAATIWLCSLLGFFYCV KIATLTHPVFVWLKYRLPGWVPWMLLSAVGMSSLTSILCFIGNYMIYQNHAKSGHQPWNV TGNSLRHSLEKFYFFSIKIIMWTIPTVVFSIFMSLLLVSLVRHMKKTFLALSELRDVWAQ AHFKALLPLLSFIVLFISCFLTLVLSSASNTPYQEFRYWMWQVVIHLCTVIHPIVILFSN PVLRVVIKRGCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF568 conjugate, 0.1mg/mL
BNC682559-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8.8), CF405S conjugate, 0.1mg/mL
BNC040689-500 1x 500 µL

Cytokeratin 8 (K8.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details