Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4F15 (OR4F15)

This Recombinant Human Olfactory receptor 4F15 (OR4F15) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4F15, Olfactory receptor OR15-14

UniProt

Q8NGB8

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGMNHSVVSEFVFMGLTNSREIQLLLFVFSLLFYFASMMGNLVIVFTVTMDAHLHSPMY FLLANLSIIDMAFCSITAPKMICDIFKKHKAISFRGCITQIFFSHALGGTEMVLLIAMAF DRYMAICKPLHYLTIMSPRMCLYFLATSSIIGLIHSLVQLVFVVDLPFCGPNIFDSFYCD LPRLLRLACTNTQELEFMVTVNSGLISVGSFVLLVISYIFILFTVWKHSSGGLAKALSTL SAHVTVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKDMKVAMRR LCSRLAHFTKIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TTC38 Antibody [Alexa Fluor 405]
NBP3-26075AF405 0.1 mL

Rabbit Polyclonal TTC38 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Bovine β 1,3 N acetylglucosaminyltransferase manic fringe (MFNG) ELISA kit
GTR10394879 96 Well

Bovine β 1,3 N acetylglucosaminyltransferase manic fringe (MFNG) ELISA kit

Sign In for Pricing
View Details
Gm12887 (NM_001099309) Mouse Untagged Clone
MC215383 10 µg

Gm12887 (NM_001099309) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-Cleaved PARP Mouse mAb
MBS8533310-01 0.1 mL

Anti-Cleaved PARP Mouse mAb

Sign In for Pricing
View Details
Anti-Cleaved PARP Mouse mAb
MBS8533310-02 0.1 mL (AF405L)

Anti-Cleaved PARP Mouse mAb

Sign In for Pricing
View Details
Anti-Cleaved PARP Mouse mAb
MBS8533310-03 0.1 mL (AF405S)

Anti-Cleaved PARP Mouse mAb

Sign In for Pricing
View Details