Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 10D3 (OR10D3)

This Recombinant Human Putative olfactory receptor 10D3 (OR10D3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Putative olfactory receptor 10D3, HTPCRX09, Olfactory receptor OR11-293

UniProt

Q8NH80

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKNCCMVTEFILLGIPHTEGLEMTLFVLFLPFYACTLLGNVSILVAVMSSARLHTPMY FFLGNLSVFDMGFSSVTCPKMLLYLMGLSRLISYKDCVCQLFFFHFLGSIECFLFTVMAY DRFTAICYPLRYTVIMNPRICVALAVGTWLLGCIHSSILTSLTFTLPYCGPNEVDHFFCD IPALLPLACADTSLAQRVSFTNVGLISLVCFLLILLSYTRITISILSIRTTEGRRRAFST CSAHLIAILCAYGPIITVYLQPTPNPMLGTVVQILMNLVGPMLNPLIYTLRNKEVKTALK TILHRTGHVPES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (Pan Nuclear Marker) (N/A), CF488A conjugate, 0.1mg/mL
BNC881816-500 1x 500 µL

Histone H1 (Pan Nuclear Marker) (N/A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), 0.2mg/mL
BNUB1882-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), 0.2mg/mL

Sign In for Pricing
View Details
CD38 Mouse Monoclonal Antibody [Clone ID: T16]
AM39017AC-N 100 Tests

CD38 Mouse Monoclonal Antibody [Clone ID: T16]

Sign In for Pricing
View Details
Cell Meter™ Live Cell Caspase 1 Binding Assay Kit *Green Fluorescence*
20108-AAT 25 Tests

Cell Meter™ Live Cell Caspase 1 Binding Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS502787 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (VIM/3736), CF568 conjugate, 0.1mg/mL
BNC683736-100 1x 100 µL

Vimentin (Mesenchymal Cell Marker) (VIM/3736), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details