Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8U8 (OR8U8)

This Recombinant Human Olfactory receptor 8U8 (OR8U8) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 8U8

UniProt

P0C7N1

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMVSESLLLASMAY DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCD DMPLLRLTCSDTRFKQLWILACAGITFICSVLIVFVSYMFIIFAILRMSSAEGRRKAFST CSSHMLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDA LKKVIINRNHAFIFLKLRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Apc4 (ANAPC4) activation kit by CRISPRa
GA109330 1 Kit

Human Apc4 (ANAPC4) activation kit by CRISPRa

Sign In for Pricing
View Details
CXorf27 (HYPM) Human Gene Knockout Kit (CRISPR)
KN419889 1 Kit

CXorf27 (HYPM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Apoc1 Mouse Gene Knockout Kit (CRISPR)
KN501416 1 Kit

Apoc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: OTI10D10]
CF809282 100 µg

ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: OTI10D10]

Sign In for Pricing
View Details
IFNA13 (IFNA1) (NM_024013) Human Over-expression Lysate
LC402974 20 µg

IFNA13 (IFNA1) (NM_024013) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45RA (158-4D3), CF555 conjugate, 0.1mg/mL
BNC550028-100 1x 100 µL

CD45RA (158-4D3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details