Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AT4 (OR2AT4)

This Recombinant Human Olfactory receptor 2AT4 (OR2AT4) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 2AT4, Olfactory receptor OR11-265

UniProt

A6NND4

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSL HKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFIL VVMAYDRYVAICHPLHYPVLMNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIY HCFCDHLAVVQASCSDTTPQTLMGFCIAMVVSFLPLLLVLLSYVHILASVLRISSLEGRA KAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNR DVKAAITKIMSQDPGCDRSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl Chloromalonate
TRC-D444060-1G 1 g

Diethyl Chloromalonate

Sign In for Pricing
View Details
CPSF7 Human Gene Knockout Kit (CRISPR)
KN402127 1 Kit

CPSF7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Synapsin III (SYN3) Human Gene Knockout Kit (CRISPR)
KN419395 1 Kit

Synapsin III (SYN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARPC5L Human Gene Knockout Kit (CRISPR)
KN401699 1 Kit

ARPC5L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PIGG (NM_001289051) Human Tagged ORF Clone
RG239747 10 µg

PIGG (NM_001289051) Human Tagged ORF Clone

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF647 conjugate, 0.1mg/mL
BNC472955-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details