Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AT4 (OR2AT4)

This Recombinant Human Olfactory receptor 2AT4 (OR2AT4) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 2AT4, Olfactory receptor OR11-265

UniProt

A6NND4

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSL HKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFIL VVMAYDRYVAICHPLHYPVLMNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIY HCFCDHLAVVQASCSDTTPQTLMGFCIAMVVSFLPLLLVLLSYVHILASVLRISSLEGRA KAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNR DVKAAITKIMSQDPGCDRSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(((Diethylamino)oxy)carbonyl)cyclopropane-1-carbonyl Chloride
TRC-D989020-2.5G 2.5 g

1-(((Diethylamino)oxy)carbonyl)cyclopropane-1-carbonyl Chloride

Sign In for Pricing
View Details
ACADM Recombinant Rabbit Monoclonal Antibody [JE48-09]
ET7109-74 100 µL

ACADM Recombinant Rabbit Monoclonal Antibody [JE48-09]

Sign In for Pricing
View Details
3-Isopropylbenzoic acid
TRC-I824468-500MG 500 mg

3-Isopropylbenzoic acid

Sign In for Pricing
View Details
Recombinant RSV Fusion protein / RSV-F (Strain RSS-2) Protein (His Tag)
PKSV030232 100 µg

Recombinant RSV Fusion protein / RSV-F (Strain RSS-2) Protein (His Tag)

Sign In for Pricing
View Details
Human ANKRD13A activation kit by CRISPRa
GA113919 1 Kit

Human ANKRD13A activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF568 conjugate, 0.1mg/mL
BNC682808-500 1x 500 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details