Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 688 (Olfr688)

This Recombinant Mouse Olfactory receptor 688 (Olfr688) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 688

UniProt

Q6W049

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTALHETNSSEVHVSEFILLGFPGIHEFQIWLSLPMALLYIVALGANLLILITIYLEPT LHQPMYQFLGILAAVDIGLATTSMPKILAILWFDAKTISLPECFAQIYAIHTFMCMESGV FLCMAIDRYVAICYPLQYPSIVTEAFVIKATLSMLLRNGLLTIPVPVLAAQRQYCSRNEI DHCLCSNLGVISLACDDITVNRFYQLALAWLVVGSDMILVYASYALIIRSVLRLNSTEAA SKALSTCSSHLILIMFYYTAIVIVSVTHLAGRRVPLIPVLLNVMHIVIPPSLNPVVYALR TQELKVGFRKVFSLSEFVSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT
YLA0001RA-01 48 Tests

Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT

Sign In for Pricing
View Details
Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT
YLA0001RA-02 96 Tests

Rat Vascular Endothelial cell Growth Factor A, VEGF-A ELISA KIT

Sign In for Pricing
View Details
PRA1 Recombinant Rabbit mAb
E43S48954 100 µL

PRA1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
VEGFR2 Rabbit Polyclonal Antibody (Cy7)
orb1052789 100 µL

VEGFR2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Endoproteinase Lys-N (MS grade)
HY-E70563 20 µg

Endoproteinase Lys-N (MS grade)

Sign In for Pricing
View Details
TRIM3 (Tripartite Motif-containing Protein 3, Brain-expressed RING Finger Protein, RING Finger Protein 22, RING Finger Protein 97, BERP, RNF22, RNF97)
T8464-75E 100 µg

TRIM3 (Tripartite Motif-containing Protein 3, Brain-expressed RING Finger Protein, RING Finger Protein 22, RING Finger Protein 97, BERP, RNF22, RNF97)

Sign In for Pricing
View Details